- Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0295823 (DDB_G0295823)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1200537
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 3,607 Da
- E Coli or Yeast
- 13150
- DDB_0266642, DDBDRAFT_0266642
- Putative uncharacterized protein DDB_G0295823 (DDB_G0295823)
Sequence
MNQLGSGPTKQGVATNTGSTGTTKNNSNLSGKGWVL